Amycolatopsis sp. FBCC-B4732: MUY14_39520 Help Entry MUY14_39520       CDS       T08335                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism aprt  Amycolatopsis sp. FBCC-B4732 Brite KEGG Orthology (KO) [BR:aprt00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MUY14_39520 Enzymes [BR:aprt01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      MUY14_39520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Motif Other DBs NCBI-ProteinID:  UOX87746 LinkDB All DBs Position 8741694..8741948 Genome browser AA seq 84 aa AA seqDB search MSNVEVEFYWRPGCGFCAALDRPMSKSGFNVRKINIWEDPSAAARVREVANGNETVPTVI VGSTAMVNPSFAEVEAAVKAASAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcaacgtcgaggtcgagttctactggcgcccggggtgcgggttctgcgccgcgctg gaccggccgatgtcgaagagcggcttcaacgtccggaagatcaacatctgggaggacccg tccgcggccgcgcgcgtgcgcgaagtcgcgaacgggaacgagacggtcccgaccgtcatc gtcgggtcgaccgccatggtcaacccgtccttcgccgaggtcgaggccgccgtcaaggca gcttcggcgggctga

DBGET integrated database retrieval system