Acetobacter pasteurianus IFO 3283-01: APA01_07330 Help Entry APA01_07330       CDS       T00988                                  Symbol tatAE Name (GenBank) protein translocase TatA/E   KO K03116   sec-independent protein translocase protein TatA Organism apt  Acetobacter pasteurianus IFO 3283-01 Pathway apt03060   Protein export apt03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:apt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     APA01_07330 (tatAE)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     APA01_07330 (tatAE)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:apt02044]     APA01_07330 (tatAE) Secretion system [BR:apt02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    APA01_07330 (tatAE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BAH98881 UniProt:  C7JEQ1 LinkDB All DBs Position 757087..757344 Genome browser AA seq 85 aa AA seqDB search MGSLSIWHWLIVLVVVLVVFGGGGKISSLMGDMAKGIKSFKKHMADDEPMDDGTARPGNG HIAPPPASSTVEQRTAAPADKSVQP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgggtagcttaagtatctggcactggctgatcgtgcttgtggttgtacttgtggtgttt ggcggcggcggcaaaatcagctcgttgatgggcgatatggccaagggcatcaaatccttc aagaaacacatggcggatgatgaaccgatggatgatggcacggcacgccccggtaacggg catattgccccaccgcccgcatcttccacagtggagcagcgcacagctgcaccagcggat aaatctgttcagccgtaa

DBGET integrated database retrieval system