KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_16110
Entry
APA01_16110       CDS       T00988                                 
Symbol
yjgPQ
Name
(GenBank) transporter YjgP/YjgQ
  KO
K11720  lipopolysaccharide export system permease protein
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:apt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    APA01_16110 (yjgPQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apt02000]
    APA01_16110 (yjgPQ)
Transporters [BR:apt02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    APA01_16110 (yjgPQ)
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: BAH99743
UniProt: C7JBJ9
LinkDB
Position
1744063..1745157
AA seq 364 aa
MSQSSSMPRHVLLRYLSMALLTRVIFCGAVLVGLLEILALLEQTTPILQRHLGIQGILSF
AAMRAPFLLAGALPLSVLIGALLMLTQMTLASEIAILRACGLSTFGLYKYLIPATLVIGF
AGVVLDDQVTPRSEQALAAWWNRTDPHPENGHAFWFHDGNRIAHIGYTSDGGNMLTKVDI
YIRDASGRLQQILHAKSADYTHTRGWLLHNVDSITVEGEKTTRLPSVQDMGWDTSLHPWE
FIRLSAENPPLSSTTILGMLRGRLPSHTSPGFLEAGLLERFLRPASLLVLLLIALPTIYI
PPRTGTRSWVPVWCLGSGLLFIIVQGMLRAMGNAGLLPPAIATIPALIIFTLGAITVLLR
NETR
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgagccaatcttcaagcatgccccgccacgttcttctccgctatctttccatggcgttg
ctcacgcgcgtgattttttgtggtgccgttcttgtcggacttcttgaaattctggctctg
cttgaacaaaccacacctattttacagcggcacttgggcatacagggtattctgagtttt
gcagccatgcgcgcgccttttctgttggcaggtgcgcttccattaagtgtgctgattggc
gcgctgcttatgctcacccagatgacattggccagcgagattgccatcctgcgtgcctgc
ggcctttctacctttggcctgtataaataccttatcccagctacgctcgttattggcttt
gccggtgttgtgctggatgatcaggtcacccctcggtctgaacaggccttggccgcatgg
tggaaccgcacagacccgcacccagaaaacgggcacgccttctggtttcatgatggcaac
cgtattgcccatattggttatacatctgatggcggcaatatgctgaccaaggtggatatc
tacattcgtgatgccagcgggcggctacagcagattctccatgctaaatctgctgattac
acgcatacgcgtggctggctcctgcacaatgttgatagcattaccgtggagggcgaaaaa
accacacgcctgccttctgttcaggacatgggctgggatacaagcctgcatccgtgggag
tttattcgcctgtctgccgaaaatccgccgctttcttccaccaccattctgggcatgtta
cgtgggcgcctgccatcccataccagccccggttttctggaggctgggctgcttgaacgc
tttttgcgtccggcatccttgcttgttcttttgttgattgcgctgcccacaatctatatc
cctccacggacaggaacgcgcagctgggtgccggtatggtgcttgggcagcgggctgttg
tttattattgtgcagggtatgctacgcgcaatgggaaatgcggggttgctaccaccggca
attgctaccatacccgcactgattattttcacactgggggccattactgtgctcctgagg
aatgaaacacgatga

DBGET integrated database retrieval system