Acetobacter pasteurianus IFO 3283-07: APA07_16050 Help Entry APA07_16050       CDS       T01813                                  Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism apu  Acetobacter pasteurianus IFO 3283-07 Pathway apu01100   Metabolic pathways apu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     APA07_16050    00074 Mycolic acid biosynthesis     APA07_16050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     APA07_16050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BAI05836 LinkDB All DBs Position 1738382..1738633 Genome browser AA seq 83 aa AA seqDB search MSETVESVSALIIQKLLANPKVPRDIDGNCKIMEDLAFDSLAVMNFVMEVEDSLDVSIPL DKLADIRTINDLAACIVALKNKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgttgaaagcgtttccgcgctgatcattcaaaagcttctcgctaacccg aaggttccgcgtgacattgatggtaactgcaagatcatggaagatctcgcttttgattct ttggccgtcatgaacttcgttatggaagttgaagacagcttggatgtttctatcccgctc gacaaactggccgatatccggacaatcaatgaccttgccgcatgcattgtcgctctgaaa aacaaagggtga

DBGET integrated database retrieval system