KEGG   Aspergillus puulaauensis: APUU_20033S
Entry
APUU_20033S       CDS       T08081                                 
Name
(RefSeq) putative secondary metabolism biosynthetic enzyme
  KO
K24856  NADPH-dependent reductase
Organism
apuu  Aspergillus puulaauensis
Pathway
apuu00254  Aflatoxin biosynthesis
apuu01100  Metabolic pathways
apuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apuu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    APUU_20033S
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C DUF374 Wax2_C
Other DBs
NCBI-GeneID: 64969606
NCBI-ProteinID: XP_041551795
LinkDB
Position
2:join(102575..102901,102950..103273,103319..103456)
AA seq 262 aa
MSDNHRLDGKVALVTGAGRGIGAAIAVALGQRGAKVVVNYANSHEAAEKVVDEIKASGSD
AIALKADVGDPEAVAKLMDKTVEHFGYLDIVSSNAGIVSFGHLKDVTPDEFDRVFRVNTR
GQFFVAREAYRHLREGGRIILTSSNTASVKGVPKHAIYSGSKGAIDTFVRCLAIDCGDKK
ITVNAVAPGAIKTDMFLAVSREYIPNGESFTDEQVDECAAWLSPLNRVGLPVDVARVVSF
LASDAAEWVSGKIIGVDGGAFR
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtccgacaaccaccgccttgatggaaaggttgcccttgtcaccggcgccggccgtgga
atcggggctgccatcgcagtagctctcggtcaacgcggcgccaaagttgtcgtcaactat
gccaactcgcacgaggccgccgagaaggttgtcgacgagatcaaagcaagcggcagtgat
gcgattgcactcaaggccgacgttggcgacccggaagctgtggcaaaattgatggacaag
actgtagagcattttgggtatcttgatattgtctcctcgaatgctgggattgtctcgttt
ggacatctcaaggatgtcacaccggacgaatttgatcgggtcttccgcgtcaacacccgc
ggccagttctttgttgcgcgtgaagcctatcgccatctacgtgaaggaggccgcatcatc
ctgaccagctccaacactgcatcggtgaaaggggtacccaagcacgccatctactccgga
tctaagggcgccattgatacattcgtccgctgcctggcgatcgactgcggcgacaagaaa
atcaccgtgaatgccgttgcacctggcgctatcaagacggacatgtttctcgctgtgtcc
cgggagtacattccgaacggcgagagctttaccgatgagcaggtcgatgagtgtgctgcg
tggttgtccccgttgaacagagtcggtctgccggtcgatgtagctcgtgtggtcagcttc
ctggcatcggacgcagcagaatgggtcagtgggaagattatcggtgttgatggaggggca
tttcgatag

DBGET integrated database retrieval system