Aquimarina sp. BL5: D1818_02035 Help Entry D1818_02035       CDS       T05615                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aqb  Aquimarina sp. BL5 Pathway aqb01100   Metabolic pathways aqb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aqb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D1818_02035    00074 Mycolic acid biosynthesis     D1818_02035   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D1818_02035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXT53964 LinkDB All DBs Position 437366..437620 Genome browser AA seq 84 aa AA seqDB search MTKEELLSKLKTIIEPYVQNQDGLHNISEDTNFIEDLEINSANLVDVILDVEDEFGIEID NDGMDKMLTIKASIEVIRDKLAAK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagaagaattactatccaaattaaaaactattatagagccttatgtgcagaac caagatggattgcataatatctccgaggatacaaatttcatagaggatttagagattaac tccgccaacttggtagatgttattctggatgtagaagatgagtttggtattgagatagat aatgacggaatggataagatgcttaccataaaggcatctatagaggtaatacgggataaa ttagcagctaaatga

DBGET integrated database retrieval system