Aquimarina sp. ERC-38: NBT05_14645 Help Entry NBT05_14645       CDS       T09583                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism aqe  Aquimarina sp. ERC-38 Brite KEGG Orthology (KO) [BR:aqe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aqe03032]     NBT05_14645    03036 Chromosome and associated proteins [BR:aqe03036]     NBT05_14645    03400 DNA repair and recombination proteins [BR:aqe03400]     NBT05_14645 DNA replication proteins [BR:aqe03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NBT05_14645 Chromosome and associated proteins [BR:aqe03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NBT05_14645 DNA repair and recombination proteins [BR:aqe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NBT05_14645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg Arteri_nsp7a VWA_2 Motif Other DBs NCBI-ProteinID:  UZO80180 LinkDB All DBs Position 3503161..3503433 Genome browser AA seq 90 aa AA seqDB search MNKTELIDAMAEDAGITKAAAKKALESFLGNVQKSLKKGDRISLVGFGSWSVSKRAAREG RNPQTGKTIKIAAKNVVKFKAGADLSGAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacagaattaattgatgcaatggcagaagatgcgggaatcacaaaggccgcc gcaaaaaaagcattggaatcatttttaggaaatgtacagaaatctcttaagaagggagat cgtatttctttagtaggtttcggatcttggtcagtatcaaaaagagctgcgagagaagga agaaaccctcaaaccggtaaaactatcaaaatcgctgctaaaaatgtagttaaatttaaa gcaggtgcagatctatcaggagctgtaaactag

DBGET integrated database retrieval system