Aquiluna borgnonia: HRU87_01715
Help
Entry
HRU87_01715 CDS
T06624
Name
(GenBank) metal-dependent transcriptional regulator
KO
K26252
DtxR family transcriptional regulator, iron-dependent repressor
Organism
aqg
Aquiluna borgnonia
Brite
KEGG Orthology (KO) [BR:
aqg00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
aqg03000
]
HRU87_01715
Transcription factors [BR:
aqg03000
]
Prokaryotic type
Helix-turn-helix
Other families
HRU87_01715
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Fe_dep_repr_C
Fe_dep_repress
MarR_2
HTH_24
HTH_Crp_2
FeoA
DUF7343
DtxR
HTH_20
MarR
HTH_1
Motif
Other DBs
NCBI-ProteinID:
QKJ24947
UniProt:
A0A7D4QME1
LinkDB
All DBs
Position
323190..323861
Genome browser
AA seq
223 aa
AA seq
DB search
MTDLIDTTEMYLKAIFELEEEGITPMRARIAERLDHSGPTVSQTVARMERDGLLRVGLDR
QLEFTDEGRLTATEVMRKHRLAERLLLEVIGLEWELVHEEACRWEHVMSEAVERKLLTLL
SDPTVSPYGMPVPGLELLGTQPPEQIPCHPVSSLSAGNYTLARIGEPIQVDQEFLLQLRD
LGLVPGVRIEVSLQAGSWLVTAQGKAEGMLLDEVIASHLFACE
NT seq
672 nt
NT seq
+upstream
nt +downstream
nt
atgaccgatttgatcgacaccaccgagatgtacctcaaagccatctttgagctggaggag
gagggcatcactccgatgcgtgcccgcatcgctgagcgcctggatcactccggccccacg
gtctcccaaactgttgcccggatggagcgagacggccttctaagggttgggctggaccgc
caactcgaattcaccgatgagggaagactcacagccaccgaggtcatgcggaagcaccgc
cttgccgaaaggttactgctagaggtaattggcctggagtgggaactggttcacgaggaa
gcctgccgctgggagcacgtcatgagcgaggcggtagagcgaaagttgctgacactgctc
tctgacccaacagtttctccctacggaatgccagttccaggattagagctattaggaact
caaccacccgagcaaattccgtgccacccggtttcctcgctgtccgccggcaattacacc
ttggctcgcatcggggagccgattcaagttgatcaggagttcttgttgcagcttcgagat
ttgggtctggtgcccggggtccgcatcgaagtgtccctgcaagctggaagctggttggtt
accgcccagggtaaagctgagggaatgctgttagatgaggtaatagcgtctcatttgttc
gcgtgtgagtaa
DBGET
integrated database retrieval system