Aquiluna borgnonia: HRU87_06915 Help Entry HRU87_06915       CDS       T06624                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism aqg  Aquiluna borgnonia Brite KEGG Orthology (KO) [BR:aqg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aqg03032]     HRU87_06915    03036 Chromosome and associated proteins [BR:aqg03036]     HRU87_06915    03400 DNA repair and recombination proteins [BR:aqg03400]     HRU87_06915 DNA replication proteins [BR:aqg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HRU87_06915 Chromosome and associated proteins [BR:aqg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HRU87_06915 DNA repair and recombination proteins [BR:aqg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HRU87_06915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  QKJ25871 UniProt:  A0A7D4TJQ4 LinkDB All DBs Position complement(1334891..1335163) Genome browser AA seq 90 aa AA seqDB search MNKSELVAAVAKHTGESQAAVGRVIDAMFDTIGAAIKKGDKVTIPGYLSVEKGHRAARSG RNPQTGATIQIAAANTVKVSAGSKLKAAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagagcgagctcgtagcagcagttgcaaagcacactggtgagtctcaggcagcc gtaggccgcgttatcgacgcaatgtttgacaccatcggtgcagcaatcaagaagggtgac aaggtcaccattcctggttacctatccgtagagaagggccaccgcgcagcacgctccggt cgcaaccctcagaccggcgcaaccatccagattgcagctgcaaacaccgtcaaggtatct gcaggtagcaagctaaaggctgcagttaagtaa

DBGET integrated database retrieval system