Aquabacter sp. L1I39: J5J86_20185 Help Entry J5J86_20185       CDS       T10434                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism aqi  Aquabacter sp. L1I39 Brite KEGG Orthology (KO) [BR:aqi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aqi03110]     J5J86_20185 (groES)    03029 Mitochondrial biogenesis [BR:aqi03029]     J5J86_20185 (groES) Chaperones and folding catalysts [BR:aqi03110]  Heat shock proteins   HSP10    J5J86_20185 (groES) Mitochondrial biogenesis [BR:aqi03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     J5J86_20185 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  QTL03056 UniProt:  A0A975DNZ6 LinkDB All DBs Position complement(4450769..4451056) Genome browser AA seq 95 aa AA seqDB search MSFRPLHDRVVVKRIEAEQKTAGGIIIPDTAKEKPQEGEVVSVGPGARDESGKVVALDVK AGDRVLFGKWSGTEVKIDGQDLLIMKESDILGVIG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtccttccgccctctgcatgaccgtgtggtcgtcaagcgcatcgaagccgagcagaag accgccggcggcatcatcatccccgacaccgccaaggaaaagccccaggagggcgaggtc gtctccgtgggccccggcgcccgcgacgagagcggcaaggtcgtggcgcttgatgtgaag gcgggcgaccgcgtcctgttcggcaagtggtccggcaccgaggtcaagatcgatggccag gacctgctcatcatgaaggaaagcgacatcctcggcgtgatcggctga

DBGET integrated database retrieval system