Aquaspirillum sp. LM1: BXU06_01455 Help Entry BXU06_01455       CDS       T04696                                  Name (GenBank) tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism aql  Aquaspirillum sp. LM1 Pathway aql00362   Benzoate degradation aql00621   Dioxin degradation aql00622   Xylene degradation aql01100   Metabolic pathways aql01120   Microbial metabolism in diverse environments aql01220   Degradation of aromatic compounds Module aql_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:aql00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BXU06_01455    00622 Xylene degradation     BXU06_01455    00621 Dioxin degradation     BXU06_01455 Enzymes [BR:aql01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      BXU06_01455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 CinA_KH Motif Other DBs NCBI-ProteinID:  AQR63881 UniProt:  A0A1U9JIH2 LinkDB All DBs Position 322784..322996 Genome browser AA seq 70 aa AA seqDB search MPYVNIKITREGASAEQKAALIAGTTALLRDILGKNPATTVVVIDEVDTDNWGIGGEVVT QLRQAQAAAR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgccttacgtcaacatcaagatcacccgcgaaggggccagcgccgagcaaaaagctgcg ctgattgccggcaccaccgccttgctgcgcgatatcctggggaaaaacccggccaccacg gtggtggtgatcgacgaggtggacactgataactggggcattggtggcgaggtggtgacc cagttgcgccaggcacaggctgccgcgcgttaa

DBGET integrated database retrieval system