Aquaspirillum sp. LM1: BXU06_05660
Help
Entry
BXU06_05660 CDS
T04696
Name
(GenBank) nitrate reductase
KO
K00372
assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
aql
Aquaspirillum sp. LM1
Pathway
aql00910
Nitrogen metabolism
aql01100
Metabolic pathways
aql01120
Microbial metabolism in diverse environments
aql01310
Nitrogen cycle
Module
aql_M00531
Assimilatory nitrate reduction, nitrate => ammonia
aql_M00615
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:
aql00001
]
09100 Metabolism
09102 Energy metabolism
00910 Nitrogen metabolism
BXU06_05660
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Molybdopterin
Molydop_binding
Molybdop_Fe4S4
Fer2_BFD
Motif
Other DBs
NCBI-ProteinID:
AQR66712
LinkDB
All DBs
Position
1294771..1297470
Genome browser
AA seq
899 aa
AA seq
DB search
MMMTVKSTCCYCGTGCGIEIDVCDGQVCGVRGDPDHPANFGRLCTKGLTLPHTLHTASRL
AEPRLRPGRTGLGEAVSWDIALDAVSDRLAAIIAEHGPESVAFYLSGQMLTEDYYVYNKL
ARGLIGTPHVDTNSRLCMSSAVTGYKLALGADAPPCSYEDFDHADCVLIAGSNMAYAHPV
LFRRLEAARTANPNMKLIVVDPRRTDTAASADLHLAIQPGTDVALFNGMLHALIWDDRLD
RGFISEHTEGFAELRHAVREYTPKMAADICGISEDALLTAARWFGEAGAALSLWCMGLNQ
SAHGTDKNLALINLHLATGQIGRPGAGPFSLTGQPNAMGGREVGGLATALSGHRDPANPQ
HRAEVAALWGVDALPATPGKTAIPMFDAIAAGQIKALWIVCTNPAHSMPDANQVREALAA
CEFVIVQDAYADTDSIDYADVLLPAAGWAEKDGTVTNSERRISRVRRAVAAPGSARADWD
IGIDAARRLAARLGRGGHLFPYAGPDEVFAEHCLTTVGRDLDIGGLSYAVLEAEGPQQWP
RPAGASQGAARLYTDHRFATDTGRARFHLTPYHGVAEAVTARYPFHLLTGRLRDQWHGMS
RSGRVPALFAHTAEAVLSMHAGDMARRGLSEGELVRMSNQHGDWVLPVQADSGMLSGQLF
VPMHWSSGFVASAGSNALTAGKMDKRSFQPELKHAAVRLDKIELAWQCAAVSACGDPVSL
LTALRPLLAECRFASATLLDGDTPAVRVRFAHPTLPSAHFLAQLDRALGLEGEAGVQQLF
SDPRRGIHKLAVWQGSRLRGVRLAGECCALGWLGERIVSGGDMGELRALVFAPQASPAGL
TRRARMVCHCAKVDETAIYQALAKGASADSLRETLGCGSGCGSCMPEVRRMAAAVSKAA
NT seq
2700 nt
NT seq
+upstream
nt +downstream
nt
atcatgatgaccgtcaaatccacctgttgctactgcggcaccggctgcggtattgaaatc
gacgtctgcgatggccaggtgtgtggcgtgcgcggcgaccccgaccatccggccaatttt
ggccggctatgcaccaagggcctcaccttgccacacaccctgcacaccgcctcgcgcctg
gccgagccacgcctgcgcccaggccgcaccggcctgggcgaggcggtcagctgggatatt
gcgctggacgccgtcagcgaccggctggcggccatcatcgccgagcacggcccggaatcg
gtggcgttttacctatccggccagatgctcaccgaagactattacgtctacaacaagctg
gcgcgtggcctgattggcaccccgcatgtggacaccaactcgcggctgtgcatgtccagc
gctgtcaccggctacaagctggcgctgggtgccgacgcgccgccgtgcagctacgaagat
tttgaccacgccgactgcgtgctgattgccggctcgaatatggcctacgcccacccggtg
ctgtttcgccggctggaagccgcgcgcaccgccaacccgaatatgaagctgattgtggtc
gatccgcgccgcaccgacaccgccgccagcgctgacctgcatctggccatccagccgggc
accgatgtggcgctgttcaacggcatgctgcatgcgctgatctgggacgaccggctggat
cggggctttatcagcgaacacaccgaaggctttgccgagctgcgccacgccgtgcgcgaa
tacaccccgaaaatggccgccgatatttgcggcatcagcgaagacgccctgctcaccgcc
gcccgctggtttggtgaagcgggcgcggcactgtcgctgtggtgcatgggcctgaatcaa
tcggcgcatggcactgacaaaaacctggcgctgattaacctgcacctggccaccggccag
attggccgccccggtgccgggccgttttcgctgaccggccagcccaatgccatgggcggg
cgcgaagtgggcggcctggccaccgcgctaagcggccaccgcgacccggccaacccacaa
caccgcgccgaagtggctgccctctggggcgtggacgcgctgccggctacgccaggcaaa
accgccattccgatgtttgacgccatcgccgccggccagatcaaggcgctgtggattgtc
tgcaccaacccggcgcactcgatgccggatgccaaccaggtgcgcgaagcgctggccgcc
tgtgaatttgtcattgtgcaggacgcctacgccgacaccgacagcatcgactacgccgat
gtgctgctgccggcagccggctgggcagaaaaagatggcacggtaaccaactccgagcgg
cgcatctcgcgcgtgcgccgcgccgtggccgcgccgggcagcgcccgcgccgactgggac
atcggcatcgacgccgcccgtcgcctggctgcccggctgggtcggggcgggcatttgttt
ccctatgccggcccggatgaagtatttgccgagcattgcctgactaccgttgggcgtgat
ctggatattggcggcttgtcgtatgccgtgctggaagccgaaggcccgcagcaatggccg
cgcccggcgggggccagccagggcgctgcgcggctgtataccgaccaccgttttgccacc
gacacaggccgcgcccgctttcacctgaccccctaccatggcgtggccgaagcggtgacg
gcgcgctatcccttccatctgctgaccggacgcctgcgtgaccagtggcacggcatgagc
cgcagcgggcgggtgccggcgctgtttgcccacactgccgaagcggtgctgagcatgcac
gccggtgacatggcccgtcgtggcctgagcgaaggcgaactggtgcgcatgagcaaccag
cacggcgactgggtgctgccggtgcaggccgacagcggcatgctgtctggccagttgttt
gtgccgatgcactggtcatcaggatttgtggccagcgccggcagcaatgcgctgaccgcc
ggcaagatggacaagcgctcgtttcagcctgagctcaagcacgcggcggtgcggctggac
aagatcgagctggcctggcagtgcgcagcggtgtcggcgtgtggcgacccggtcagcctg
ctcaccgccctgcgccccctgctggccgaatgccgctttgccagcgccaccctgctggat
ggcgatacaccggcagtgcgtgtgcgctttgcccaccccaccctgccttcggcgcatttt
cttgctcagctggatcgtgcgctggggctggagggtgaagctggcgtgcaacagctgttc
agcgacccgcgtcggggcatccacaaactggcggtctggcagggcagccgcttgcgcggc
gtgcgtctggctggcgagtgttgtgcgctgggctggctgggcgagcgcattgtcagcggt
ggcgacatgggcgagctgcgcgcgctggtgtttgccccgcaggccagccccgccgggctg
acccgccgggcgcgcatggtgtgccattgcgccaaggtggatgaaaccgcgatttatcag
gcgctggccaagggcgccagcgctgacagcctgcgcgagacgctgggctgtggcagtggt
tgtggttcgtgcatgccggaggtgcggcggatggcggcggcggtgagcaaggcggcgtga
DBGET
integrated database retrieval system