Aquaspirillum sp. LM1: BXU06_12760 Help Entry BXU06_12760       CDS       T04696                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism aql  Aquaspirillum sp. LM1 Pathway aql00361   Chlorocyclohexane and chlorobenzene degradation aql00362   Benzoate degradation aql00623   Toluene degradation aql01100   Metabolic pathways aql01120   Microbial metabolism in diverse environments aql01220   Degradation of aromatic compounds Module aql_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:aql00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BXU06_12760    00361 Chlorocyclohexane and chlorobenzene degradation     BXU06_12760    00623 Toluene degradation     BXU06_12760 Enzymes [BR:aql01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      BXU06_12760     1.14.13.244  phenol 2-monooxygenase (NADH)      BXU06_12760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  AQR65827 UniProt:  A0A1U9JNX9 LinkDB All DBs Position 2957767..2958039 Genome browser AA seq 90 aa AA seqDB search MASHAFIAFQKNEESRCIVEAIVEDNPGAIVSDQPAMVKVDVPGQLVIRRATVEDKMGRA FDLQELQLHLITISGHLDETDDEFTLSWNA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcctcccacgcttttattgcttttcagaaaaacgaagaatcgcgctgcatcgtcgag gcgattgttgaagacaaccccggtgccatcgtcagcgaccagccggccatggtgaaagtg gacgtacccggccagctggtgatccgccgcgccaccgtagaagacaaaatgggccgcgcc tttgatctgcaggaactgcaactgcacctgatcaccatttctggccacctggacgaaacc gacgacgaattcactctgagctggaacgcctga

DBGET integrated database retrieval system