Aquaspirillum sp. LM1: BXU06_12770 Help Entry BXU06_12770       CDS       T04696                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism aql  Aquaspirillum sp. LM1 Pathway aql00361   Chlorocyclohexane and chlorobenzene degradation aql00362   Benzoate degradation aql00623   Toluene degradation aql01100   Metabolic pathways aql01120   Microbial metabolism in diverse environments aql01220   Degradation of aromatic compounds Module aql_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:aql00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BXU06_12770    00361 Chlorocyclohexane and chlorobenzene degradation     BXU06_12770    00623 Toluene degradation     BXU06_12770 Enzymes [BR:aql01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      BXU06_12770     1.14.13.244  phenol 2-monooxygenase (NADH)      BXU06_12770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  AQR65829 UniProt:  A0A1U9JP35 LinkDB All DBs Position 2959618..2959980 Genome browser AA seq 120 aa AA seqDB search MTLLKTLADYDFPSRDALENYQGRQLLYINWEKHRMFSRPFVLALPPDTPFAQIIDQHMA GCFSYHPDWAQIDWHSVQWLNGRTPFTPDRDKSLRDNGIGHKDLIRLITPGLNGIAGSGY NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgaccctgctgaaaaccctggccgactacgattttccgtcacgcgacgcgctggaaaac taccaaggccgccagctgctgtacatcaactgggaaaaacaccggatgttctcgcgcccg tttgtgctggcgctgccgccggacaccccgtttgcccagatcatcgaccagcacatggcc ggctgcttcagctaccaccccgactgggcgcagattgactggcacagcgtgcagtggctg aacggacgcaccccgttcacccccgaccgggacaaaagcctgcgcgacaacggcatcggc cacaaagacctgatccgcctgattacccccggcctgaatggcattgccggcagcggttac taa

DBGET integrated database retrieval system