KEGG   Aquaspirillum sp. LM1: BXU06_12945
Entry
BXU06_12945       CDS       T04696                                 
Name
(GenBank) spermidine/putrescine ABC transporter ATP-binding protein
  KO
K11072  spermidine/putrescine transport system ATP-binding protein [EC:7.6.2.11]
Organism
aql  Aquaspirillum sp. LM1
Pathway
aql02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aql00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BXU06_12945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aql02000]
    BXU06_12945
Enzymes [BR:aql01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.11  ABC-type polyamine transporter
     BXU06_12945
Transporters [BR:aql02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter
    BXU06_12945
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 AAA_22 ORC-CDC6-like SMC_N ABC_ATPase AAA_28 RsgA_GTPase Rad17 nSTAND3 AAA_16 AAA_25 AAA nSTAND1 Se-cys_synth_N NACHT AAA_5 AAA_29 AAA_14 ATPase_2 TsaE Topoisom_bac
Other DBs
NCBI-ProteinID: AQR65860
LinkDB
Position
2990698..2991786
AA seq 362 aa
MALLEIRNVVKQFADFTAVNHVSLSVEAGEFFTLLGPSGCGKTTLLRMLAGFEQPDSGEI
LLDGKDVSTVPPEKRPVHTVFQSYALFPHMTVRENIAFPLKMAGWAADKIAPQVDELLED
VRLGKFGQRYPHELSGGQRQRVAIARALVDRPRLLLLDEPLSALDAKLREEMQIELINLQ
KEVGITFVYVTHDQAEALALSHRIAVMSAGQVEQLDKPETIYSYPRNRFVADFIGQCNVL
DSEVKAIHGDGSMTIAIKGCGEMKALARDGVTVGQQGWLALRPEKIKLDRELPELPNEAY
FKGRVHDCLYMGDVTLYIVEVGEGVRIEAMLPNSAPGLAKLFDDNDPVEIAWRFDAGSFL
TE
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcgcttcttgaaattcgtaatgtggtcaagcagttcgctgactttaccgcagtgaat
catgtcagcctgtcggtggaagccggcgagttcttcaccctgctcgggccgtccggctgc
ggcaagaccaccctgctgcgcatgctggctggctttgaacagcccgacagtggcgaaatc
ctgctcgatggcaaggatgtgtccactgtgccgccggaaaagcgcccggtgcatacggta
ttccaaagctacgcgctgtttccgcacatgaccgtgcgcgaaaacatcgccttcccgctg
aaaatggccggctgggccgccgacaaaatcgccccgcaagtggacgaattgctggaagac
gtgcggttgggcaaattcggccagcgttacccgcacgagctgtccggcggccagcgccag
cgggtggcgattgcccgtgccctggtggatcgtccgcgtttgttgctgctggacgagccg
ctgtcggcgctggatgccaagctgcgcgaagaaatgcagatcgagctgatcaatctgcaa
aaggaagttggcatcacttttgtctacgtgacccacgaccaggccgaggcgctggcgctg
tcgcaccggattgcggtgatgagcgcgggtcaggtggagcagctggacaagccggaaacc
atctacagctacccgcgcaaccgctttgtggcggacttcatcggccagtgcaatgtgctg
gacagtgaagtgaaggccattcatggtgatggcagcatgaccatcgccatcaagggctgt
ggagaaatgaaggcgctggcgcgcgacggggtgacggtggggcagcagggctggctggcg
ctgcgcccggaaaaaatcaagctcgaccgcgaactgccggaactgcccaacgaagcctac
ttcaagggccgggtgcatgactgtctgtacatgggcgacgtgacgctatacatcgtcgaa
gtaggcgagggtgtgcgcatcgaggccatgctgcccaattcggcccccggcctggccaag
ctgtttgacgacaatgacccggttgaaatcgcctggcggtttgacgccggcagcttcctg
acggagtaa

DBGET integrated database retrieval system