Aquitalea sp. USM4: DKK66_08415 Help Entry DKK66_08415       CDS       T05865                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism aqs  Aquitalea sp. USM4 Brite KEGG Orthology (KO) [BR:aqs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aqs03036]     DKK66_08415 Chromosome and associated proteins [BR:aqs03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DKK66_08415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RsmF-B_ferredox ZapB CENPH YabA Med21 SlyX USHBP1_PDZ-bd DUF7310 Cep57_CLD_2 FliT Troponin PI3K_P85_iSH2 STAT_alpha DUF2802 SKA2 ACBP4_C Cnn_1N Knl1_RWD_C Asd-4 FlgN DUF7620 TMF_DNA_bd ABC_tran_CTD Motif Other DBs NCBI-ProteinID:  QBJ78112 UniProt:  A0A4P6TJG8 LinkDB All DBs Position 1769230..1769457 Genome browser AA seq 75 aa AA seqDB search MDKELEYLESRVQALVARIKELETQNGRFAQALAEALKENAELNFRVNETRSRVAALVER LPKAEEPEQAEGEAE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggacaaggaactggaatatctcgaatcccgcgtgcaggccctggttgcccgcatcaag gaactggaaacccagaacggccgttttgcccaggcgctggctgaagcgctgaaggaaaac gccgagctgaatttccgcgtgaacgaaacacgcagccgcgtggccgcgctggtagaacgt ctgcccaaggcagaggaaccggagcaggctgaaggagaggcagaatga

DBGET integrated database retrieval system