Aquitalea sp. USM4: DKK66_17440 Help Entry DKK66_17440       CDS       T05865                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism aqs  Aquitalea sp. USM4 Brite KEGG Orthology (KO) [BR:aqs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aqs03032]     DKK66_17440    03036 Chromosome and associated proteins [BR:aqs03036]     DKK66_17440    03400 DNA repair and recombination proteins [BR:aqs03400]     DKK66_17440 DNA replication proteins [BR:aqs03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DKK66_17440 Chromosome and associated proteins [BR:aqs03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DKK66_17440 DNA repair and recombination proteins [BR:aqs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DKK66_17440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Lmo2446-like_N Motif Other DBs NCBI-ProteinID:  QBJ79692 UniProt:  A0A4P6TN61 LinkDB All DBs Position complement(3793612..3793887) Genome browser AA seq 91 aa AA seqDB search MTKQQLIAILSEKTGCSKVDVLRFMDALEQTIRDELVSGGEVTLASTGKFKVKNTAERNG RNPKTGETVLIPAKRKVVFTPIKLLKEAVAG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccaaacaacaactcattgccatcctttccgaaaaaaccggctgcagcaaagtcgat gtcctgcgcttcatggatgcgctggaacagaccattcgtgatgagctggtcagcggtggt gaggtcacgctggccagtaccggcaagttcaaggtgaaaaatacggcggagcgcaatggc cgcaatccgaaaaccggcgaaaccgtgctgatcccggcaaagcgcaaggtggtgttcacc cccatcaagctgctgaaggaagccgtagccggctga

DBGET integrated database retrieval system