Amphimedon queenslandica (sponge): 100631544 Help Entry 100631544         CDS       T02284                                  Name (RefSeq) cystatin-B-like isoform X2   KO K13907   cystatin-A/B Organism aqu  Amphimedon queenslandica (sponge) Brite KEGG Orthology (KO) [BR:aqu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:aqu01002]     100631544   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aqu04147]     100631544 Peptidases and inhibitors [BR:aqu01002]  Peptidase inhibitors   Family I25: cystatin family    100631544 Exosome [BR:aqu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100631544 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  100631544 NCBI-ProteinID:  XP_003389363 UniProt:  A0A1X7U028 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MAVVAGGLRDELPADAAIQKLVDKVRVSVEEKSGRKFTEFRAIAYCTQVVAGVNYFIKVC VGTNDYVMLRVYQSLDQEVTLSSYQLDKKESDPIEYFD NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcggtcgtagctggagggttgagggacgaactacctgccgatgcggccatacagaaa ctagtagataaagttagagtatccgtagaggaaaagtctggtagaaaatttactgagttc agggccattgcatactgcactcaagtggtagcaggagtaaattactttattaaagtatgt gttggtactaatgattacgttatgttacgtgtctatcagagtcttgatcaagaggtaact ctcagctcctaccagttggacaagaaagaaagcgatccaatcgaatattttgattag

DBGET integrated database retrieval system