Amphimedon queenslandica (sponge): 100638385 Help Entry 100638385         CDS       T02284                                  Name (RefSeq) ras-like GTP-binding protein RHO   KO K04513   Ras homolog gene family, member A Organism aqu  Amphimedon queenslandica (sponge) Pathway aqu04081   Hormone signaling aqu04144   Endocytosis aqu04150   mTOR signaling pathway aqu04310   Wnt signaling pathway aqu04350   TGF-beta signaling pathway aqu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aqu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100638385    04350 TGF-beta signaling pathway     100638385    04150 mTOR signaling pathway     100638385   09133 Signaling molecules and interaction    04081 Hormone signaling     100638385  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100638385  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100638385  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aqu04131]     100638385   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aqu04147]     100638385    04031 GTP-binding proteins [BR:aqu04031]     100638385 Membrane trafficking [BR:aqu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100638385 Exosome [BR:aqu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100638385   Exosomal proteins of other body fluids (saliva and urine)    100638385   Exosomal proteins of colorectal cancer cells    100638385   Exosomal proteins of bladder cancer cells    100638385 GTP-binding proteins [BR:aqu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100638385 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  100638385 NCBI-ProteinID:  XP_003385965 UniProt:  A0A1X7V1M3 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MASTRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKCVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPTVPIVLVGNKKD LRYDEGTRRELSKSKQEPVKTEEGRAMADKIGAYNYLECSAKLNEGVREVFETATRAALA TKKKKKGKCNLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggccagtacacgaaagaaacttgtaatcgttggtgatggagcatgtggtaaaacatgc ttactcattgtcttttcaaaagatcagttccctgaagtatatgttcctactgtttttgaa aattatgttgctgatattgaagtagatggaaaatgtgtggaacttgctttgtgggatact gctggtcaggaggactatgacaggctacgtcctctgtcatatccagacactgatgttatc cttatgtgtttttcgattgatagtccagattctttggaaaatatccctgagaaatggact cctgaagtgagacacttctgtccaacagttcccatcgttttggttggaaataagaaagat ctacgctatgatgaaggcacacgccgggaactctcaaaatcaaagcaggaaccggtaaaa acggaagaaggccgtgccatggctgataagattggggcctacaattatttggagtgctca gccaaactgaatgagggggttcgagaagtttttgaaacagcaacccgagctgctttggca acaaaaaagaagaagaaagggaaatgcaatcttctttaa

DBGET integrated database retrieval system