Amphimedon queenslandica (sponge): 105313691 Help Entry 105313691         CDS       T02284                                  Name (RefSeq) cystatin-A-like   KO K13907   cystatin-A/B Organism aqu  Amphimedon queenslandica (sponge) Brite KEGG Orthology (KO) [BR:aqu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:aqu01002]     105313691   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aqu04147]     105313691 Peptidases and inhibitors [BR:aqu01002]  Peptidase inhibitors   Family I25: cystatin family    105313691 Exosome [BR:aqu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105313691 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  105313691 NCBI-ProteinID:  XP_011405631 UniProt:  A0A1X7UAU2 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MEPTIPGEFVKERPADDGIQKIADKVKVAVEEQSGRKFTEFKAIAFRSQVVAGVNYIIKV CVGHGKNDYIMLRVFENLDGEVTLTSYELDKKKDDPIEVSD NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggagcctaccatacctggagagtttgtgaaagagcgaccggccgatgatggtatacag aaaatagctgacaaagttaaagtagctgtagaggaacagtctggtagaaaatttacggag ttcaaggccattgcatttcgctctcaagtggtagcaggagtgaattacattattaaagta tgtgttggtcatggtaaaaatgattacataatgttgcgtgtctttgagaatcttgatgga gaggtaactcttacttcctacgagttggacaagaaaaaggatgacccaattgaagtttct gattaa

DBGET integrated database retrieval system