Amphimedon queenslandica (sponge): 109589080 Help Entry 109589080         CDS       T02284                                  Name (RefSeq) stefin-C-like   KO K13907   cystatin-A/B Organism aqu  Amphimedon queenslandica (sponge) Brite KEGG Orthology (KO) [BR:aqu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:aqu01002]     109589080   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aqu04147]     109589080 Peptidases and inhibitors [BR:aqu01002]  Peptidase inhibitors   Family I25: cystatin family    109589080 Exosome [BR:aqu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109589080 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin LTD Motif Other DBs NCBI-GeneID:  109589080 NCBI-ProteinID:  XP_019860763 UniProt:  A0A1X7TA88 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MSNYKQLADFGPETDANEDTQKIADTVKVSLEEKTGRKFAEFKAMSFRSQPVSGMNYIIK ICVGRSTYDYIWVRVYNNLDGEVSLTSYRLDKKKDDPIEVFE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtcgaactacaaacaactagccgactttgggccggagacggacgccaatgaggacaca cagaaaatagcggacacagttaaagtatccctagaggaaaagactggtagaaaatttgca gagttcaaggccatgtcattccgctctcaacctgtatcaggaatgaattacattattaaa atatgtgttggtcgtagtacatatgattacatatgggtgcgtgtctataacaatcttgat ggagaggtaagtctcacttcctaccggttggacaagaaaaaggatgacccaattgaagtt tttgaataa

DBGET integrated database retrieval system