Rhizobium rhizogenes K84: Arad_12163 Help Entry Arad_12163        CDS       T00850                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ara  Rhizobium rhizogenes K84 Pathway ara00362   Benzoate degradation ara00621   Dioxin degradation ara00622   Xylene degradation ara01100   Metabolic pathways ara01120   Microbial metabolism in diverse environments ara01220   Degradation of aromatic compounds Module ara_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:ara00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     Arad_12163    00622 Xylene degradation     Arad_12163    00621 Dioxin degradation     Arad_12163 Enzymes [BR:ara01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      Arad_12163 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 ECM11 Motif Other DBs NCBI-ProteinID:  ACM31209 UniProt:  B9JPZ0 LinkDB All DBs Position pAtK84c:121910..122104 Genome browser AA seq 64 aa AA seqDB search MPWIRVDLSTGRTVEQKQKAAEAITDALVKFCNCSPESVSIVFNDVTADNWAFAGKLLSQ TAKP NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgccttggattcgagtggatttatctacgggccgtaccgttgagcaaaaacagaaggct gccgaggccatcactgacgcgctggtgaagttttgcaactgctcacccgagtcggtcagc atcgtgttcaacgacgtgaccgcggacaactgggcctttgcaggcaagcttctttcgcaa accgcaaaaccctaa

DBGET integrated database retrieval system