KEGG   Agrobacterium radiobacter: Arad_14155
Entry
Arad_14155        CDS       T00850                                 
Symbol
noxB
Name
(GenBank) D-nopaline dehydrogenase
  KO
K24953  nopaline oxidase subunit B
Organism
ara  Agrobacterium radiobacter
Pathway
ara00330  Arginine and proline metabolism
ara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Arad_14155 (noxB)
SSDB
Motif
Pfam: DAO Pyr_redox_3 Pyr_redox_2 HI0933_like Pyr_redox NAD_binding_8 3HCDH_N FAD_binding_3 ApbA FAD_binding_2 F420_oxidored UDPG_MGDP_dh_N TrkA_N
Other DBs
NCBI-ProteinID: ACM31019
UniProt: B9JPF0
LinkDB
Position
pAtK84b:complement(107745..108863)
AA seq 372 aa
MDHEFETAIVGGGVVGAAIGYGLAKLGRRVIIIDGADDALRASRTNFGLIWVQGKGDEYP
EYHRITRQSAELWPGFASELKELTGVDVEYRRNGGLLFCVSEAQAEEEKAIGEKMAAIHP
DYRFEMLERSRLERMLPDIRLGPKVCSASFSHMDGDVNPLLVLRALLEGFVRLGGTLVTG
EHVDSIAPTLGGFRLATDGLTIEAERVIIAAGNDSMAFAKSLDLPLLLVPEKGQLLITER
VAPVFPYAASGIRQTMTGTFQLGVTNERVGRSTDVTAGGARHIANRAISVMPDVGALRVI
RQWAGLRVLTPDGVPVYDRSRRYPGIHVVACHSGVTLAALHAGPFAEWLAADGREPSYDA
FRGSRFKMGIAA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggatcacgagttcgagacggccattgttggcggcggcgtagtgggcgccgcaattgga
tacgggttagccaagttggggcgccgggtgatcatcatcgatggcgcggacgatgcgctg
cgtgcgtcccgaacaaatttcggcctgatctgggttcaaggcaagggcgacgaatatcct
gaatatcatcgcatcacgcggcaaagcgctgagctgtggccaggttttgcctccgagttg
aaagagctgaccggtgtcgacgtagagtaccgccgcaacggtggtttgctcttttgtgtg
tcggaagctcaggcggaagaagaaaaagccatcggcgagaagatggctgccattcatcct
gactatcgtttcgagatgctggagcgctcgcgccttgagcgcatgcttcccgacatccgt
ctcgggccgaaggtgtgttcagcgtcgttcagtcatatggacggtgacgtcaatcctctc
ctggtccttcgcgctttgctggagggatttgtgcgcctcggtggaaccttggtgacgggc
gaacacgtcgacagcatcgcgcccacgcttggtggcttccgactggcaacggatggcctc
acgatagaagcggagcgggtgattattgcagcgggaaatgactccatggcttttgccaag
agcctggaccttccgcttctgctcgttccggaaaaggggcagcttctcatcacggaacgg
gtcgccccggtatttccttacgccgccagcggtattcgtcagactatgacgggcacgttt
cagctcggcgttacgaatgaacgtgtgggccggtctaccgatgtgacagctggcggcgca
cgtcatatcgccaatcgcgcgatcagtgtgatgcctgacgtcggcgcgttgcgtgtcata
aggcaatgggcgggactccgcgtgctgaccccggatggggtgccggtctacgatcggtcg
cggcgataccccggcatccatgtcgtcgcatgccattccggcgtcacccttgccgctctg
catgcgggtccttttgccgaatggttggcagccgatggaagggagccatcctacgacgct
ttccgcggcagcagattcaagatggggatcgcggcgtga

DBGET integrated database retrieval system