Rhizobium rhizogenes K84: Arad_4411 Help Entry Arad_4411         CDS       T00850                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism ara  Rhizobium rhizogenes K84 Pathway ara00400   Phenylalanine, tyrosine and tryptophan biosynthesis ara01100   Metabolic pathways ara01110   Biosynthesis of secondary metabolites ara01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:ara00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     Arad_4411 Enzymes [BR:ara01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      Arad_4411 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  ACM28129 UniProt:  B9JCL8 LinkDB All DBs Position 1:3529613..3529915 Genome browser AA seq 100 aa AA seqDB search MIDPDVKAQLGNYRQSIDNIDAALVHMLAERFRCTKEVGVLKAKYNLPPADPAREEFQIE RLRLLARDANLDPDFAEKFLNFVIKEVIRHHEQIAADLKA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgattgatccagacgtcaaggcccaattgggcaactaccgccagtcgatcgataatatc gatgcagccttggtgcatatgctggccgaacgcttccgctgtaccaaagaggtcggcgtg ctgaaggccaaatacaatctgccgccggctgacccggcgcgcgaggaattccagatcgaa cgcctgcgccttctggcaagggacgccaatctggacccggatttcgccgagaagttcctg aacttcgtcatcaaggaagtcatccggcatcacgaacagatcgctgctgatctcaaagca tga

DBGET integrated database retrieval system