Rhizosphaericola mali: E0W69_006195 Help Entry E0W69_006195      CDS       T06233                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism arac  Rhizosphaericola mali Brite KEGG Orthology (KO) [BR:arac00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:arac03032]     E0W69_006195    03036 Chromosome and associated proteins [BR:arac03036]     E0W69_006195    03400 DNA repair and recombination proteins [BR:arac03400]     E0W69_006195 DNA replication proteins [BR:arac03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E0W69_006195 Chromosome and associated proteins [BR:arac03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E0W69_006195 DNA repair and recombination proteins [BR:arac03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E0W69_006195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 HU-CCDC81_bac_2 Arteri_nsp7a Motif Other DBs NCBI-ProteinID:  QES88275 UniProt:  A0A5P2FYL0 LinkDB All DBs Position 1426919..1427218 Genome browser AA seq 99 aa AA seqDB search MNKSELIDLLASKAGTTKTDAGKVLDAFTETVTETLAGGDSVTLIGFGTFSVSERSARNG RNPQTGETIKIKASKVAKFKAGKVVSEAVNAKQKKKATK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatctgaattaatagacttattggcttctaaagctggcacaaccaagaccgat gccggtaaagtattggacgcttttaccgaaactgtaaccgaaactttagccggtggcgac tctgttaccttaattggttttggaacatttagcgtgtctgaacgttctgcccgtaacggt cgcaacccgcaaaccggtgaaaccatcaaaatcaaagccagcaaagttgcgaagttcaag gccggtaaagtagttagcgaagccgtaaatgcaaagcagaagaaaaaagctacgaaataa

DBGET integrated database retrieval system