Acidovorax radicis: KI609_06995 Help Entry KI609_06995       CDS       T08078                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism arad  Acidovorax radicis Pathway arad01100   Metabolic pathways arad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arad00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KI609_06995 (acpP)    00074 Mycolic acid biosynthesis     KI609_06995 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KI609_06995 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  UCV00504 LinkDB All DBs Position 1541484..1541723 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgcgtcaaaaaaatcattgccgagcaactcggtgtagaagag tcccaagtcaccaatgaaaaagcctttgtggcagacctcggtgccgactcgctcgacacg gtggaactggtgatggctctggaagacgagttcggcatcgagatcccggacgaagacgcc gagaagatcacaacggtgcaaaacgccattgactacgccaacacccaccagaaggcctga

DBGET integrated database retrieval system