Acidovorax radicis: KI609_08950
Help
Entry
KI609_08950 CDS
T08078
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
arad
Acidovorax radicis
Pathway
arad02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
arad00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
KI609_08950 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
arad02022
]
KI609_08950 (phoB)
Two-component system [BR:
arad02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
KI609_08950 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
GerE
Motif
Other DBs
NCBI-ProteinID:
UCV00848
LinkDB
All DBs
Position
1965391..1966098
Genome browser
AA seq
235 aa
AA seq
DB search
MRKLPRVLIVEDEPAIAELIAVNLRHNGFQPFWAEDGDSAQRELDAVLPDVILLDWMLPG
QSGLSLARKWRADSRTKPIPILMLTARGDEPDKVAGLDAGADDYITKPFSTQELLARIRA
VLRRRAPEQVSDSVAIGELVLDAATYRVTFQGQSLKVGPTEFKLLHFLMKHAERVHSRSQ
LLDKVWGDHVFIEERTVDVHVKRLREALGGASNMVETVRGAGYRLTAQPQTQLQA
NT seq
708 nt
NT seq
+upstream
nt +downstream
nt
atgagaaagctcccccgtgttctgatcgtggaggacgagcccgccattgccgagctgatt
gccgtcaacctgcgccacaacggattccagcccttctgggcggaagatggcgattctgcc
cagcgcgagctggatgccgtgctgcccgatgtcatcctgctcgactggatgctgccaggg
cagagcggcctgtcgcttgcccgcaagtggcgcgccgacagccgcaccaagcccataccc
atcctgatgctcacagcgcgcggggatgagcccgacaaagtggcggggctggatgcaggg
gctgatgactacatcaccaagcccttttcgacgcaggagcttcttgcccgcattcgcgcc
gtgctgcgccgccgcgcgcccgagcaggtgagcgacagtgtggcgattggtgaactggtg
ctggatgcggcgacgtaccgcgtcactttccaggggcagtcactcaaagtggggcctacc
gagttcaagctgctgcatttcctgatgaaacatgccgaacgtgtgcacagccgctcgcaa
ctgctcgacaaggtgtggggcgaccatgtctttattgaagagcgcacggtggacgtgcac
gtcaagcgtctgcgcgaagccctgggtggcgcatccaatatggtggaaaccgtgcgcggg
gcaggctaccggctgacggcgcaaccacaaacacaactgcaggcctga
DBGET
integrated database retrieval system