KEGG   Agrobacterium radiobacter: ACN9MK_14485
Entry
ACN9MK_14485      CDS       T11332                                 
Name
(GenBank) formate dehydrogenase beta subunit
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
arai  Agrobacterium radiobacter
Pathway
arai00630  Glyoxylate and dicarboxylate metabolism
arai00680  Methane metabolism
arai01100  Metabolic pathways
arai01120  Microbial metabolism in diverse environments
arai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACN9MK_14485
  09102 Energy metabolism
   00680 Methane metabolism
    ACN9MK_14485
SSDB
Other DBs
NCBI-ProteinID: XRS30650
LinkDB
Position
2:complement(77975..79531)
AA seq 518 aa
MSVTVFIPGDSAALAVGANRVAEAISREATSRNLDVHIVRNGSRGMLWLEVLVEVRTEHG
RIAYGPVKASDVASLFDAGFLTGGEHRLCLGPTKDIPFLKSQTRLTFARCGVTDPLSLED
YRAYQGMKGLEKAVAMAPLDIVTQVTESGLRGRGGAGFPTGIKWKTVADAVADQKYIVCN
ADEGDSGTFADRMIMEGDPFVLIEGMAIAGLAVGATKGFIYTRSEYPYAIKVMEQAIEIA
RREGILGPSVLGSGRAFDMEVRMGAGAYVCGEETSLLNSLEGKRGTVRAKPPLPALQGLF
GKPTVVNNVISLASIPVIMDRGAAFYRDFGVGRSHGTIPIQLAGNIKHGGLYETVFGLPL
GRLVNDIGGGTITGRPVKAVQVGGPLGAYFPVSLFDTTFDYEAFTAAGGLIGHAGIVVFD
DTADMLHQARFALEFCAVESCGKCTPCRIGSTRGVETVDKIALGIEREKNTALLEDLCET
MKFGSLCALGGFTPYPVMSALRHFPADFAPIPRVEAAE
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgagtgtcaccgtttttattcccggcgattccgccgcgctggccgtcggcgcaaaccgc
gtggccgaagcgatcagccgcgaggccaccagccgcaatctcgatgtgcatattgtccgc
aacggttcgcgcggcatgctctggcttgaggtgctggtggaagtgcgcaccgagcatggc
cgtattgcctacgggccggtcaaagcgagcgacgttgcttcgctcttcgatgcagggttt
ctcaccggcggcgagcatcggctctgtctcgggccaaccaaggatatcccattcctgaaa
agccagacgcgtctcacatttgcgcgttgtggcgtcaccgatccgctgtcgcttgaggat
tatcgcgcctatcagggcatgaaaggccttgaaaaagccgtcgccatggcaccgctggac
attgttacccaggtgactgaaagcggcctgcgcggacgtggtggcgcgggtttcccgacg
ggtatcaaatggaagaccgttgcggatgcggtcgcggaccagaaatacatcgtctgcaat
gcggacgagggcgatagcggcaccttcgccgaccgcatgatcatggaaggcgatcccttc
gtgctgatcgaaggcatggcgattgccggccttgccgtcggcgcgacgaagggcttcatc
tatacgcgctcggaatatccttacgctatcaaggtcatggagcaggcgatcgagatcgcc
cggcgcgaaggcattcttggcccgtccgtgctcggctccggccgcgcctttgatatggaa
gtacgcatgggcgcgggcgcttatgtctgcggcgaggaaacctcgcttctgaacagtctt
gaaggcaaacgcggcacggtgcgcgccaagccgcctctgcccgccctgcagggcctgttc
ggcaagcccaccgtcgtcaacaatgtcatttcgctcgcctccattccagtcatcatggat
cgcggcgcggcgttttatcgcgatttcggcgttggccgttcgcatggcaccatcccgatc
cagcttgccggaaacatcaaacacggcgggctttacgagaccgtcttcggcctgccgctc
ggacggctcgtcaatgatatcggtggcggcacgatcaccggccgccccgtcaaggcggtg
caggtgggtggtccgctcggggcctatttcccggtttccttattcgacacgaccttcgac
tacgaggcctttaccgctgccggtggcctgatcggccatgcgggtatcgtggttttcgat
gacacggccgacatgctccatcaggcgcggtttgcgcttgagttctgtgccgtcgaaagc
tgcggcaagtgcacgccctgccgcatcggctcgacgcgcggcgtcgagacggtggacaag
atcgcgctcggcatcgagcgggagaaaaacaccgcactcctcgaagacctctgcgaaacc
atgaaattcggttcgctctgcgcgctcggcggcttcacgccctatccagtgatgagcgcg
ctccggcatttccctgctgattttgcccccatcccacgtgttgaagcggcggagtaa

DBGET integrated database retrieval system