Aminithiophilus ramosus: KAR29_03100 Help Entry KAR29_03100       CDS       T08824                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aram  Aminithiophilus ramosus Pathway aram01100   Metabolic pathways aram01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aram00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KAR29_03100 (acpP)    00074 Mycolic acid biosynthesis     KAR29_03100 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KAR29_03100 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 Motif Other DBs NCBI-ProteinID:  QTX33657 UniProt:  A0A9Q7F170 LinkDB All DBs Position complement(712505..712750) Genome browser AA seq 81 aa AA seqDB search MEEIQKRLKDIVIDRLDVEEEQIKADASFVEDLGADSLDIVELIMGIEEEFDIEIPDEDA EKLTNVEEAMNYVKNKLGIEE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaagaaattcagaagcgcctgaaggatatcgtcatcgatcgcctcgacgttgaagag gagcagatcaaggccgatgcctcctttgtcgaggaccttggagccgactccctcgatatc gtcgagctcatcatgggcatcgaggaggagttcgatatcgagattcccgatgaggacgcc gaaaagctgaccaatgtcgaggaagccatgaattacgtcaagaacaagctggggatcgag gagtaa

DBGET integrated database retrieval system