Arachidicoccus sp. BS20: A9P82_06950
Help
Entry
A9P82_06950 CDS
T04406
Name
(GenBank) glycine--tRNA ligase
KO
K01880
glycyl-tRNA synthetase [EC:
6.1.1.14
]
Organism
arb
Arachidicoccus sp. BS20
Pathway
arb00970
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:
arb00001
]
09120 Genetic Information Processing
09122 Translation
00970 Aminoacyl-tRNA biosynthesis
A9P82_06950
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
arb01007
]
A9P82_06950
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
arb03016
]
A9P82_06950
03029 Mitochondrial biogenesis [BR:
arb03029
]
A9P82_06950
Enzymes [BR:
arb01000
]
6. Ligases
6.1 Forming carbon-oxygen bonds
6.1.1 Ligases forming aminoacyl-tRNA and related compounds
6.1.1.14 glycine---tRNA ligase
A9P82_06950
Amino acid related enzymes [BR:
arb01007
]
Aminoacyl-tRNA synthetase
Class II (C/G)
A9P82_06950
Transfer RNA biogenesis [BR:
arb03016
]
Eukaryotic type
Aminoacyl-tRNA synthetases (AARSs)
Other AARSs
A9P82_06950
Mitochondrial biogenesis [BR:
arb03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial transcription and translation factors
Other mitochondrial DNA transcription and translation factors
A9P82_06950
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HGTP_anticodon
tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID:
ANI90664
LinkDB
All DBs
Position
1538482..1539954
Genome browser
AA seq
490 aa
AA seq
DB search
MSTQAENNFQSIIAHAKEYGFVFPSSEIYDGLSAVYDYGPYGSELKKNIRDYWWKSMTQL
NDNIVGIDAAIFMHPTTWKASGHVDNFSDPMIDNKDSKKRYRVDHLIEAFAETITAQGKE
SEAQNILQQMDALLAKDDFAGLKKLIDDNKITCSISGTSNWTEIRQFNLMFKTEFGAVAS
DNPDDNIVYLRPETAQGIFVNFLNVQKTARMKVPFGIAQTGKAFRNEIVARQFIFRMREF
EQMEMQFFVRPGTEGEWYKYWKAERLKWHLSLGIDASKYRYHDHVKLAHYAKEACDIEFE
FPIGFKEVEGIHSRSDFDLSQHQLYSKKKQQYFDTDIDPATGKPYGNYIPYVIETSIGLD
RMFLLILSNAYHEETIAKEDGSTDSRVVLHINPKIAPVKLAIFPLTKKDGLPEIAQEIFD
DCKQDFRCFYEEKDAIGKRYRRQDALGTPFAITIDHQTKEDRTVTIRYRDSMQQERISID
EIKAKIKASL
NT seq
1473 nt
NT seq
+upstream
nt +downstream
nt
atgagcacacaagcagaaaataattttcaatccattatagcgcacgccaaagaatatggc
tttgtttttccgagcagcgaaatttatgacggtctcagcgccgtatatgattacggtccg
tacggaagtgaattgaagaaaaatatccgcgattattggtggaaatcgatgacgcaactg
aacgataatattgtgggaattgatgccgcaattttcatgcatccgacaacatggaaagcg
agtggacacgtggacaatttcagcgacccgatgattgacaacaaagatagcaagaagcgt
tatcgtgttgaccatttgattgaagcttttgccgaaacgattacagcgcaaggaaaagaa
agcgaagcgcaaaatattttacaacaaatggatgcgttgcttgcgaaagatgattttgca
ggtttgaaaaaattaatcgacgataataaaattacatgcagcatcagcggaacaagtaac
tggacagaaattcgccagtttaatttaatgttcaaaacagaatttggagcagttgcaagt
gataatcctgatgataatattgtttacctgcgccccgaaactgcacaaggcatttttgtc
aattttttgaatgtgcaaaagacggcaagaatgaaagtaccttttggcattgcacaaact
ggtaaagcatttcgtaacgaaattgttgcgcgacaatttattttccgtatgcgcgaattt
gaacaaatggaaatgcagttttttgttcgccccggcacggaaggcgaatggtataaatat
tggaaggcagaacgattaaaatggcatttgagcttaggcattgatgcaagcaaatatcgt
tatcacgaccacgtgaaattggctcactatgcaaaagaagcctgcgatattgaatttgaa
tttcccattggttttaaagaagtcgaaggcattcattcgcgcagcgattttgatttatcg
cagcatcaattgtacagcaaaaagaagcaacaatattttgatacagacattgaccctgcg
accggaaaaccttatggcaactacattccgtatgtaatagaaacgtcgattggtttggac
agaatgtttttgttaatcttgtcaaacgcttatcacgaagaaacaattgcaaaagaagac
ggctcaaccgattcaagagttgtattgcatatcaacccgaaaattgcgcctgtaaaactc
gcaatatttccattaaccaaaaaagatggattgcccgaaattgcacaggaaatttttgac
gattgcaaacaagatttccgttgcttttacgaagagaaagatgccatcggaaaacgttac
agaagacaagatgcgcttggcacgccgttcgccattacgattgaccaccaaacaaaagaa
gacagaactgttacgattcgttaccgcgattccatgcaacaggaaagaatttccatcgat
gaaatcaaagcgaagattaaagcatcattgtaa
DBGET
integrated database retrieval system