Arthrobacter sp. ERGS1 01: AL755_20790 Help Entry AL755_20790       CDS       T04085                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism are  Arthrobacter sp. ERGS1:01 Brite KEGG Orthology (KO) [BR:are00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:are03032]     AL755_20790    03036 Chromosome and associated proteins [BR:are03036]     AL755_20790    03400 DNA repair and recombination proteins [BR:are03400]     AL755_20790 DNA replication proteins [BR:are03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AL755_20790 Chromosome and associated proteins [BR:are03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AL755_20790 DNA repair and recombination proteins [BR:are03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AL755_20790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  ALE07352 UniProt:  A0A0M4LRQ7 LinkDB All DBs Position complement(3730720..3731007) Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAAKAETSQTAVNGVLDALFSVFESSVAAGEKITIPGWLSIERTDRAAR TGRNPQTGETIQIAAGHSVKLSAGSKLKAAVSTKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaaaaatcgtagcgaactggttgccgaagttgccgcaaaggctgagaccagccag accgcagtaaacggcgttctggatgcactcttctcggtattcgagagctccgttgcagcc ggcgaaaagatcaccatcccgggctggctctccatcgagcgcaccgaccgtgcagctcgc accggccgcaacccccagacgggcgagaccatccagatcgcagccggccacagcgtcaag ctgtccgcaggctcgaagctgaaggctgctgtctccaccaagaagtag

DBGET integrated database retrieval system