Anaerostipes rhamnosivorans: AR1Y2_3246 Help Entry AR1Y2_3246        CDS       T05962                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism arf  Anaerostipes rhamnosivorans Pathway arf01100   Metabolic pathways arf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AR1Y2_3246    00074 Mycolic acid biosynthesis     AR1Y2_3246   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AR1Y2_3246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 PP-binding_2 Baculo_19 MCM_WH_arc DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QCP36700 UniProt:  A0A4V1EGN5 LinkDB All DBs Position complement(3265809..3266042) Genome browser AA seq 77 aa AA seqDB search MLEKMKEIIAEQLSVDESEIALETSFKDDLGADSLDLFELVMALEEEYDVEIPSDDLTEL NTVEDVINYLKNKGVED NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgttagagaaaatgaaggaaatcattgcagaacagttaagcgttgatgaaagtgaaatt gcgttagagacatctttcaaagatgacttaggagctgactccctggacttatttgaatta gtaatggcattagaagaagagtacgatgtagagattccgtctgacgacctgacagagctt aatactgtcgaagatgtaatcaactacttaaagaataaaggcgtagaagattaa

DBGET integrated database retrieval system