Amycolatopsis rhabdoformis: VSH64_35365 Help Entry VSH64_35365       CDS       T09694                                  Name (GenBank) 2-hydroxymuconate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism arhd  Amycolatopsis rhabdoformis Pathway arhd00362   Benzoate degradation arhd00621   Dioxin degradation arhd00622   Xylene degradation arhd01100   Metabolic pathways arhd01120   Microbial metabolism in diverse environments arhd01220   Degradation of aromatic compounds Module arhd_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:arhd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     VSH64_35365    00622 Xylene degradation     VSH64_35365    00621 Dioxin degradation     VSH64_35365 Enzymes [BR:arhd01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      VSH64_35365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  WSE28089 LinkDB All DBs Position complement(7685560..7685760) Genome browser AA seq 66 aa AA seqDB search MPLVQVTLSAGRTPDQVRALISALTTAVTTSIGAPKEAVRVIVSEVPPTHWAAGDVTLAE RTPTDG NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgccgctcgtccaggtcacgctcagcgcgggccgcaccccggaccaggtccgcgcgctg atcagcgcgctgaccaccgccgtcaccacctcgatcggcgcgccgaaggaggcggtccgg gtcatcgtctccgaggtgccgcccacccactgggccgccggcgacgtcaccctcgcggaa aggacccccaccgatggctga

DBGET integrated database retrieval system