Amycolatopsis rhabdoformis: VSH64_48255 Help Entry VSH64_48255       CDS       T09694                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism arhd  Amycolatopsis rhabdoformis Pathway arhd00998   Biosynthesis of various antibiotics arhd01100   Metabolic pathways arhd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arhd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VSH64_48255    00074 Mycolic acid biosynthesis     VSH64_48255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VSH64_48255 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  WSE30501 UniProt:  A0ABZ1I8Y2 LinkDB All DBs Position complement(10362175..10362420) Genome browser AA seq 81 aa AA seqDB search MADNAEILAGLAEIVEEVAGVAQDDVTAEKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DELANLKTVGDAVNYVSANQK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgacaacgctgagatcctcgccggcctcgccgagatcgtcgaagaggtggccggt gtggctcaggacgacgtcaccgccgagaagtcgttcgtggacgacctggacatcgactcg ctgtcgatggtcgagatcgccgtgcaggccgaggacaagttcggcgtcaagatcccggac gacgagctcgccaacctgaagaccgtgggcgacgcggtgaactacgtgtccgccaaccag aagtaa

DBGET integrated database retrieval system