Psychromicrobium lacuslunae: UM93_12010 Help Entry UM93_12010        CDS       T03775                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism ari  Psychromicrobium lacuslunae Brite KEGG Orthology (KO) [BR:ari00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ari03032]     UM93_12010    03036 Chromosome and associated proteins [BR:ari03036]     UM93_12010    03400 DNA repair and recombination proteins [BR:ari03400]     UM93_12010 DNA replication proteins [BR:ari03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     UM93_12010 Chromosome and associated proteins [BR:ari03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     UM93_12010 DNA repair and recombination proteins [BR:ari03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       UM93_12010 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding DUF2267 HU-HIG GST_C HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AJT42051 UniProt:  A0A0D4C137 LinkDB All DBs Position complement(2553012..2553314) Genome browser AA seq 100 aa AA seqDB search MAKNRSELVAEVAAKAETSQAAVNNVLDAVFSVFESSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVAKKAPAKKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctaagaatcgtagtgagcttgttgctgaggttgctgccaaggctgagaccagccag gctgcagtgaacaacgttttggatgcggttttctccgtattcgaaagctcagttgccgct ggcgagaagatcaccatcccgggctggctcgcagttgagcgcaccgaccgtgcagctcgc accggccgcaacccgcagaccggtgagaccattcagatcgccgctggccacagcgttaag ctgaccgctggctccaagctgaaggctgccgttgcgaagaaggctccggccaagaagaag taa

DBGET integrated database retrieval system