Aeromonas rivuli: KYK33_04955 Help Entry KYK33_04955       CDS       T07884                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ariv  Aeromonas rivuli Pathway ariv01100   Metabolic pathways ariv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ariv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KYK33_04955    00074 Mycolic acid biosynthesis     KYK33_04955   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KYK33_04955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Phytase Motif Other DBs NCBI-ProteinID:  UBO74906 LinkDB All DBs Position 1027525..1027779 Genome browser AA seq 84 aa AA seqDB search MQDLQLEIKQLIIDSLNLEGLTPDDIDSQAPLFGDGLGLDSIDALELGLAIKGRYGIVLS ADDENTRRHFASVAALVALVQSQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaagacctgcaactagagataaagcaactcattatcgacagcctcaatctggaagga ttgaccccggacgacatcgacagccaggctcccctgtttggggatggtctgggcctggac tccatcgatgcgctcgagctcgggctcgccatcaagggtcgctacggcatagtgctctcc gccgatgacgagaatacccgtcgtcactttgccagtgtcgcagccctggttgccttggtt cagtcccaagcctga

DBGET integrated database retrieval system