Arachidicoccus soli: D6B99_13480 Help Entry D6B99_13480       CDS       T05648                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ark  Arachidicoccus soli Pathway ark00190   Oxidative phosphorylation ark01100   Metabolic pathways Module ark_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ark00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     D6B99_13480 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ark00194]     D6B99_13480 (atpE) Photosynthesis proteins [BR:ark00194]  Photosystem and electron transport system   F-type ATPase [OT]    D6B99_13480 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF3999 Motif Other DBs NCBI-ProteinID:  AYD48525 UniProt:  A0A386HRP1 LinkDB All DBs Position complement(3219304..3219555) Genome browser AA seq 83 aa AA seqDB search MSLLNTVMLQADGMAKGLGAVGAGVAALGAGVGIGQIGKGAVEAIARQPEASGDIRANMI LAAALVEGVAFLGVIAGILAIVL NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctttattgaacactgtaatgttacaagccgacggaatggctaaaggtcttggtgct gttggcgcaggtgttgctgcacttggtgctggcgtaggtatcggccaaattggtaaaggt gcggttgaagctattgctcgtcaaccagaagcttctggcgacatccgtgcaaacatgatt cttgctgctgcccttgtagaaggtgttgccttcttgggtgtaattgcaggtatcttggca atcgtactttaa

DBGET integrated database retrieval system