Arthrobacter sp. 'calajunan' LS16: AFL94_07825 Help Entry AFL94_07825       CDS       T04078                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism arl  Arthrobacter sp. 'calajunan' LS16 Pathway arl01100   Metabolic pathways arl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFL94_07825    00074 Mycolic acid biosynthesis     AFL94_07825   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFL94_07825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Pro_sub2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALD63830 LinkDB All DBs Position 1743914..1744159 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNSETGLDEADVQLDKSFTEDLDIDSISMMTIVVEAEEKFEVKIPD EEVKNLKTVGDAVNFIAGAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggcaggcctcgccgaaatcgttaactcggagaccggc ctggacgaagcagacgtgcagctggacaagtccttcaccgaggacctggacatcgactcg atctcgatgatgaccatcgtcgttgaggccgaggaaaagttcgaggtcaagattccggac gaggaagtcaagaacctgaagaccgtgggcgacgccgtgaacttcatcgccggcgcccag gcctag

DBGET integrated database retrieval system