Arthrobacter sp. PAMC 25486: ART_1003 Help Entry ART_1003          CDS       T03487                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism arm  Arthrobacter sp. PAMC 25486 Brite KEGG Orthology (KO) [BR:arm00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     ART_1003 Enzymes [BR:arm01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      ART_1003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_2 Glrx-like Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  AIY00602 UniProt:  A0A0A1CTK6 LinkDB All DBs Position 1004935..1005192 Genome browser AA seq 85 aa AA seqDB search MDFTPETGSITMFSTTWCGYCKRLKKQLDTAGIGYTEINIEDVPGTAELVESLNGGNQTV PTVLFPDGTAATNPSLNDVKAKLGV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtggatttcacccccgagaccggatcaatcaccatgttttccaccacctggtgcggctac tgcaagcgcctgaagaagcagcttgacactgcagggattggctacacggagatcaacatc gaggacgttcccggcaccgccgaactcgttgaaagcctcaacggcggcaaccagacggtc cccaccgtactgttcccggatggcaccgcagccaccaacccctcactgaacgatgtgaag gccaagctgggcgtctag

DBGET integrated database retrieval system