Arthrobacter sp. PAMC 25486: ART_1152 Help Entry ART_1152          CDS       T03487                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism arm  Arthrobacter sp. PAMC 25486 Pathway arm00998   Biosynthesis of various antibiotics arm01100   Metabolic pathways arm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ART_1152    00074 Mycolic acid biosynthesis     ART_1152   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ART_1152 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Pro_sub2 Ribosomal_L50 Ag332 Motif Other DBs NCBI-ProteinID:  AIY00751 LinkDB All DBs Position 1160709..1160954 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPEAVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIPD EEVKNLKTVGDAVSFIAGAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggctggattggccgaaatcgtcaacgaagagaccggc ctggcccctgaggcagtagagctggacaagtccttcacggatgacctggacatcgattcc atctccatgatgaccattgttgtcaacgccgaagagaagttcgatgtgaagatcccggac gaggaagtcaagaacctcaagaccgttggcgacgccgtcagcttcatcgcaggcgcgcag gcataa

DBGET integrated database retrieval system