Arthrobacter sp. PAMC 25486: ART_1449 Help Entry ART_1449          CDS       T03487                                  Name (GenBank) F0F1 ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism arm  Arthrobacter sp. PAMC 25486 Pathway arm00190   Oxidative phosphorylation arm01100   Metabolic pathways Module arm_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:arm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ART_1449  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:arm00194]     ART_1449 Photosynthesis proteins [BR:arm00194]  Photosystem and electron transport system   F-type ATPase [OT]    ART_1449 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF4233 Cytochrom_C_asm Motif Other DBs NCBI-ProteinID:  AIY01048 UniProt:  A0A0A1CVQ9 LinkDB All DBs Position complement(1491674..1491889) Genome browser AA seq 71 aa AA seqDB search MELHGSLNMIGYGLAAIGSAIGVGMIFAAYINGVARQPEAQRILQPIALLGFALAEALAI LGLVFAFVVGV NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggaactccacggctcgctcaacatgattggctacggcctggccgctatcggctcggca attggtgtgggcatgatcttcgccgcatacatcaacggtgtagcacgccagcctgaagct cagcgcatcctgcagcccatcgccctgcttggcttcgcccttgcagaagcattggctatc cttggcctggtcttcgccttcgtcgttggcgtctag

DBGET integrated database retrieval system