Arthrobacter sp. YN: CGK93_13415 Help Entry CGK93_13415       CDS       T05171                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism arn  Arthrobacter sp. YN Brite KEGG Orthology (KO) [BR:arn00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CGK93_13415 Enzymes [BR:arn01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CGK93_13415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_2 GST_N_3 Glrx-like Flagellin_IN Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  ASN20564 UniProt:  A0A221NKU2 LinkDB All DBs Position 2972448..2972708 Genome browser AA seq 86 aa AA seqDB search MDFTPDSGTITMFSTTWCGYCNRLKKQLDAKGIGYTEINIEEVDGTAELVEQLNGGNRTV PTVLFPDGTAATNPSASEVEKRLVAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggacttcactcccgactccggcaccatcaccatgttctcgaccacctggtgcggttac tgcaaccgcctgaagaagcagctggatgccaagggcatcggctacaccgagatcaacatc gaagaagtggatggcactgccgaactcgtcgagcagctcaacggaggcaaccgcaccgtc cccaccgtcctcttccccgacggaaccgcagcaaccaacccctccgcttccgaggttgaa aagcgcctggtcgccgcctaa

DBGET integrated database retrieval system