Rhizobium rhizogenes K599: B0909_07880 Help Entry B0909_07880       CDS       T04767                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aro  Rhizobium rhizogenes K599 Pathway aro01100   Metabolic pathways aro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0909_07880    00074 Mycolic acid biosynthesis     B0909_07880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0909_07880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  AQS62177 LinkDB All DBs Position 1:774192..774428 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgtaattgatcatcttggcgttgacgcc gacaaggttgtcgaaggcgccagcttcattgacgatctgggcgctgattcgctcgacacc gttgaactggtcatggctttcgaagaagaattcggcgttgaaattcccgacgacgcagcg gactcgatcctgaccgttggcgacgccgtcaagttcatcgaaaaggcccaggcctga

DBGET integrated database retrieval system