Rhizobium rhizogenes K599: B0909_18645 Help Entry B0909_18645       CDS       T04767                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aro  Rhizobium rhizogenes K599 Pathway aro01100   Metabolic pathways aro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0909_18645    00074 Mycolic acid biosynthesis     B0909_18645   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0909_18645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Gp44-like_2nd Diox-like_N Motif Other DBs NCBI-ProteinID:  AQS65277 LinkDB All DBs Position 2:1180143..1180379 Genome browser AA seq 78 aa AA seqDB search MSEIRNRVIKIISEQLGIADDKIVDTANFSEDLNADSLEVVQIVMEIEEEFGIEIPDAAA DSLSTVGDAIRFIQLATT NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atatccgagataagaaaccgggtgataaaaatcatcagcgagcagctcggaatagcggat gacaaaatagtcgatacagcaaatttttccgaagatctgaatgccgattcacttgaggtc gttcagatcgtcatggagatcgaagaggaatttggcatcgaaattcccgatgctgccgca gacagcctctccactgtcggtgatgccattcgcttcattcagctggcaacaacttaa

DBGET integrated database retrieval system