Athalia rosae (coleseed sawfly): 105683865 Help Entry 105683865         CDS       T09776                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism aroa  Athalia rosae (coleseed sawfly) Pathway aroa04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aroa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105683865  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aroa04121]     105683865    03400 DNA repair and recombination proteins [BR:aroa03400]     105683865 Ubiquitin system [BR:aroa04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      105683865    Cul5 complex      105683865 DNA repair and recombination proteins [BR:aroa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105683865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Motif Other DBs NCBI-GeneID:  105683865 NCBI-ProteinID:  XP_012252231 LinkDB All DBs Position 6:3948796..3951274 Genome browser AA seq 126 aa AA seqDB search MDVFLMIRRKKTTIFTDAKDNTTVLELKKIIEGILKIPPANQQLYSKDIVLMSDNKCLSD YGMTSSVAKAQCPALVALAIRGEGEQFEPLEMTPYSLPPDLPDVMKEVTDQGKIILKFPT VKPYSE NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggacgtatttcttatgatcaggcggaagaaaaccacgatttttacagatgctaaagat aatactaccgtcctagaactcaaaaaaatcattgaaggtatactgaagatacctccagcg aaccaacagctgtacagcaaagatattgttctaatgtcagacaacaaatgtctatctgat tacggaatgacgtcgtcagttgcaaaagcacaatgtcctgctttggtagcattagccata cgtggagaaggcgaacaatttgaaccacttgaaatgacaccatattcgttaccacctgat cttcctgacgttatgaaggaagttaccgatcaagggaaaattatcttaaaatttccaaca gtcaaaccttacagcgagtaa

DBGET integrated database retrieval system