Athalia rosae (coleseed sawfly): 105688881 Help Entry 105688881         CDS       T09776                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism aroa  Athalia rosae (coleseed sawfly) Pathway aroa04814   Motor proteins Brite KEGG Orthology (KO) [BR:aroa00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     105688881  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aroa03037]     105688881    04812 Cytoskeleton proteins [BR:aroa04812]     105688881 Cilium and associated proteins [BR:aroa03037]  Motile cilia and associated proteins   Dynein arm    105688881 Cytoskeleton proteins [BR:aroa04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105688881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  105688881 NCBI-ProteinID:  XP_012260937 LinkDB All DBs Position 6:complement(10238019..10239640) Genome browser AA seq 111 aa AA seqDB search MEDMQEETQFVVDDVSKIIKDAIEVSIGGNAYQHTKVNQWTSHVVEACLGNLTKLQKPYK YIVTCTIMQKNGAGLHTASSCFWDNATDGSCTVRWENKTMYCIVSVFGLAI NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaagacatgcaggaggagactcagttcgtggtggatgatgttagcaaaattataaaa gatgcgatcgaagtctcaattggaggtaacgcttaccagcacacaaaagtgaatcaatgg acatctcacgtagttgaagcctgcctgggaaacctaactaagttacagaagccgtacaaa tatatcgtgacttgtaccatcatgcagaagaacggagctggcctgcatacagccagttct tgcttttgggataacgcaacagatggaagttgcaccgtgcgttgggaaaacaaaaccatg tactgtattgtatctgtttttggtctggccatttaa

DBGET integrated database retrieval system