Athalia rosae (coleseed sawfly): 105692021 Help Entry 105692021         CDS       T09776                                  Name (RefSeq) BLOC-1-related complex subunit 7   KO K20821   BLOC-1 related complex subunit 7 Organism aroa  Athalia rosae (coleseed sawfly) Pathway aroa04142   Lysosome biogenesis Brite KEGG Orthology (KO) [BR:aroa00001]  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome biogenesis     105692021  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aroa04131]     105692021 Membrane trafficking [BR:aroa04131]  Endosome - Lysosome transport   Arf GTPases and associated proteins    BLOC-one-related complex (BORC)     105692021 SSDB OrthologParalogGFIT Motif Pfam:  BORCS7 DUF4354 YAF2_RYBP Motif Other DBs NCBI-GeneID:  105692021 NCBI-ProteinID:  XP_012266314 LinkDB All DBs Position 2 Genome browser AA seq 105 aa AA seqDB search MASASSTSARSLFVDSKMRLADRVQVNVNNVASLARQIQRGSRSSEILMHSSRNFALQEN GFENAEANLKKLALITAHLEFQLDAIDRSSGKLEEVTEQVRAMQR NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcctcggcatcaagtacaagtgctcgaagcctgtttgttgattcaaagatgaggtta gcagacagagtgcaagttaatgtcaataatgttgcctcgttagcccggcaaatacagagg ggatcccgtagcagcgagatattaatgcattcctcgaggaatttcgcgctgcaggaaaac ggtttcgaaaatgcggaagcgaatttgaagaaactagcgctcatcacggctcatttagaa ttccaactagatgccatcgataggagttctggaaaattggaagaagtcacggaacaagta cgtgccatgcaaagatga

DBGET integrated database retrieval system