Athalia rosae (coleseed sawfly): 105693350 Help Entry 105693350         CDS       T09776                                  Name (RefSeq) histone H2B.1, sperm-like   KO K11252   histone H2B Organism aroa  Athalia rosae (coleseed sawfly) Brite KEGG Orthology (KO) [BR:aroa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aroa03036]     105693350   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aroa04147]     105693350 Chromosome and associated proteins [BR:aroa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105693350 Exosome [BR:aroa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105693350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  105693350 NCBI-ProteinID:  XP_012268619 LinkDB All DBs Position 1:142393..143396 Genome browser AA seq 107 aa AA seqDB search MPSRRSGTPVRKGKRREYSYNRYIHKVLKDVDAQFGLTGRAMEIMNSFMADMFGRIATEA SRLATYNGKVTVTPREIQTAVRLLVPGDLGKFAVAAGARAVTKYSTS NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgccttctcgcagaagcgggacgccggtacgcaagggcaaacggagggaatacagctac aaccgttacattcacaaggtgttgaaggacgtggacgcccagttcggattaaccggcagg gcgatggagataatgaacagcttcatggctgacatgttcggtcgaatcgcgacggaggct tcgcggctggcgacgtacaacggcaaagtgacggtgaccccgagagaaattcagaccgcc gtcaggctcctcgttcccggagatttggggaaattcgccgtcgcggcgggcgcgagagcc gtcacgaaatacagcacgtcgtga

DBGET integrated database retrieval system