Amycolatopsis roodepoortensis: NQK81_00145 Help Entry NQK81_00145       CDS       T08507                                  Name (GenBank) glutaredoxin family protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism aroo  Amycolatopsis roodepoortensis Brite KEGG Orthology (KO) [BR:aroo00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     NQK81_00145 Enzymes [BR:aroo01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      NQK81_00145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_9 GST_N SH3BGR DUF7489 Motif Other DBs NCBI-ProteinID:  UUV31889 LinkDB All DBs Position complement(28263..28502) Genome browser AA seq 79 aa AA seqDB search MSDLIVYGAGWCPDVKRSRALLDSKGIEYDYVDVEADSGAEETVRALQNGERRIPTIVWP DGTHLVEPSDDELTAHLNR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacctcatcgtgtacggcgccggctggtgccccgacgtcaaacgcagccgtgcc ctcctggactcgaagggcatcgagtacgactacgtcgacgtcgaggcggattccggcgcg gaggagaccgtgcgggcgctgcagaacggtgaacggcggatcccgacgatcgtctggccg gacggcacccacctggtcgagccgagcgacgacgagctcaccgcccacctgaaccggtga

DBGET integrated database retrieval system