KEGG   Amycolatopsis roodepoortensis: NQK81_32900
Entry
NQK81_32900       CDS       T08507                                 
Symbol
thrC
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aroo  Amycolatopsis roodepoortensis
Pathway
aroo00260  Glycine, serine and threonine metabolism
aroo00750  Vitamin B6 metabolism
aroo01100  Metabolic pathways
aroo01110  Biosynthesis of secondary metabolites
aroo01120  Microbial metabolism in diverse environments
aroo01230  Biosynthesis of amino acids
Module
aroo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aroo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NQK81_32900 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NQK81_32900 (thrC)
Enzymes [BR:aroo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NQK81_32900 (thrC)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: UUV29534
LinkDB
Position
6870580..6871641
AA seq 353 aa
MISQPWPGIIQAYPDRIPVPSGAKVITLGEGNTPLLPAPHLSELTGCEVYLKVEGVNPTG
SFKDRGMTVAITHALASGLQAVICASTGNTSASAAAYAARAGLTCAVLVPQGKIAMGKLA
QAVQHGARILQVDGNFDDCLELAQKTAIDYPVTLVNSVNPVRIAGQKSAAFEICDVLGRA
PDIHCLPVGNAGNITAYWAGYSEYAGDGVVKNTPRMFGFQAAGAAPLVHGEPVADPDTIA
TAIRIGSPASWDGAMKAKNASAGLFEAITDEKILEAYRLLARKEGVFVEPASATSVAGLL
ATAADGRLPKGSTVVCTVTGHGLKDPATALEGNVEVEPLAVDPTAVAAALDLR
NT seq 1062 nt   +upstreamnt  +downstreamnt
gtgatttcccaaccgtggccggggatcatccaggcttatccggaccggatcccggtccct
tccggcgcgaaggtgatcacgctcggcgaaggcaacacgccgctgctgcccgccccgcac
ctttccgaactcaccgggtgcgaggtctacctcaaggtcgagggcgtgaacccgaccggg
tcgttcaaggaccgcgggatgaccgtggccatcacgcacgcgctcgccagcgggctccag
gcggtcatctgcgcctccaccgggaacacctcggcgtcggccgcggcgtacgcggcccgc
gccgggctcacctgcgcggtcctcgtcccgcagggcaagatcgcgatgggcaaactggcg
caggccgtccagcacggcgcgcggatcctgcaggtggacggcaacttcgacgactgcctc
gaactcgcgcagaagaccgcgatcgactacccggtgaccctggtcaactcggtgaacccg
gtgcgcatcgccggccagaagtcggccgcgttcgagatctgcgacgtgctcggccgggct
ccggacatccactgcctgccggtcggcaacgcgggcaacatcaccgcctactgggccggg
tattccgagtacgcgggcgacggtgtggtgaagaacaccccgcggatgttcggcttccag
gcggccggtgccgcacctctcgtgcacggcgagccggtggccgatcccgacaccatcgcg
accgcgatccgcatcggcagccccgcgtcctgggacggcgcgatgaaggcgaagaacgcg
tccgccggcctgttcgaggcgatcaccgacgagaagatcctcgaggcgtaccggctgctc
gcccgcaaggaaggcgtgttcgtcgagcccgcttcggcgaccagcgtggcgggcctgctc
gccacggccgccgacgggcgcctgccgaagggttcgaccgtcgtgtgcaccgtcaccgga
cacggcctgaaggacccggccacggcgctggagggcaacgtcgaggtcgagccgctcgcc
gtcgacccgaccgccgtcgccgccgcgctggacctgcgatga

DBGET integrated database retrieval system